PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe6G143600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 221aa    MW: 25895.7 Da    PI: 8.9897
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe6G143600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.71.1e-171360148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g WT+eEd ll+++++++G g+W++++ + g++R++k+c++rw +yl
  Aqcoe6G143600.1.p 13 KGTWTEEEDTLLKRCIEKYGEGNWHKVPLRAGLNRCRKSCRLRWINYL 60
                       799*******************************************97 PP

2Myb_DNA-binding46.39.7e-1570110547
                        -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        + +E +l+++ +k+lG++ W++Ia++++ gRt++++k+rw+++
  Aqcoe6G143600.1.p  70 SWDEIDLIIKMHKLLGNR-WSLIAARLP-GRTANDIKNRWNTH 110
                        779***************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.901864IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-22963IPR009057Homeodomain-like
SuperFamilySSF466891.31E-2810107IPR009057Homeodomain-like
SMARTSM007172.6E-161262IPR001005SANT/Myb domain
PfamPF002497.8E-171360IPR001005SANT/Myb domain
CDDcd001674.65E-111560No hitNo description
Gene3DG3DSA:1.10.10.601.3E-2064115IPR009057Homeodomain-like
SMARTSM007171.1E-1365113IPR001005SANT/Myb domain
PROSITE profilePS5129417.39265115IPR017930Myb domain
PfamPF002492.3E-1370110IPR001005SANT/Myb domain
CDDcd001672.74E-970111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 221 aa     Download sequence    Send to blast
MGRKISCTTG LKKGTWTEEE DTLLKRCIEK YGEGNWHKVP LRAGLNRCRK SCRLRWINYL  60
NPNIKREELS WDEIDLIIKM HKLLGNRWSL IAARLPGRTA NDIKNRWNTH IFKSLQKQQS  120
ETITPNKIKV IKPQPWTFPK KFQDIKSTHN STEKKATQCG EQLHEKSLLE FENEQSIKWL  180
ENFLLDKKDE FAIDSSSFDD IVPDIDMSVL LDLNLWESLE *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-21111155108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010062250.13e-65PREDICTED: transcription factor MYB113-like
SwissprotQ9FNV91e-58MY113_ARATH; Transcription factor MYB113
TrEMBLC4PAV23e-71C4PAV2_AQUFO; R2R3-myb transcription factor
STRINGVIT_14s0006g01290.t012e-58(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66370.17e-60myb domain protein 113